If you have been reading about Nicotinamide riboside and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2025-08-16. Where a claim depends on a specific study, the study is described rather than over-claimed.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide found in cells. Its structure consists of a nicotinamide ring linked to ribose phosphate, and the compound serves as an intermediate in the salvage pathway for nicotinamide adenine dinucleotide, or NAD+. In this pathway, nicotinamide phosphoribosyltransferase converts nicotinamide and phosphoribosyl pyrophosphate into NMN, after which NMN adenylyltransferase attaches an adenylate group to produce NAD+. Because NAD+ participates in redox reactions and signaling, NMN occupies a central position in cellular metabolism. The molecule is distinct from nicotinamide riboside, though the two are related in NAD+ precursor research.
Beyond its intracellular synthesis, NMN can be taken up from the extracellular environment, although the routes are still debated. Some evidence points to direct transport into cells through specific transporters, while other work suggests dephosphorylation to nicotinamide riboside followed by cellular uptake. Once inside, NMN can be converted to NAD+ by NMN adenylyltransferases; the relative contribution of these routes may differ by tissue, species, and experimental conditions. Researchers continue to investigate which mechanisms dominate in intact organisms and how they affect measured NAD+ levels. Direct measurement in tissues remains technically challenging because NMN can be rapidly metabolized during sample collection.
Nicotinamide mononucleotide, usually shortened to NMN, is a naturally occurring nucleotide. Its structure consists of a nicotinamide base linked to a ribose sugar that carries a phosphate group. In cells, NMN serves as an intermediate in the salvage pathway that produces nicotinamide adenine dinucleotide, or NAD+. Because NAD+ participates in many oxidation-reduction reactions, NMN sits near central metabolic processes. The compound is not a drug in most jurisdictions and is discussed mainly in biochemistry and nutrition research.
The term NMN commonly refers to the beta isomer, in which the nicotinamide group is attached to the ribose through a beta-glycosidic bond. Commercial material may be supplied as the free acid or as a salt, such as a sodium salt, which affects molecular weight and water solubility. Related compounds include nicotinamide riboside and NAD+ itself, but these are distinct molecules with different formulas and cellular handling. Laboratory research often uses the beta form because it matches the naturally occurring configuration found in biological systems.
| Property | Value | Notes |
|---|---|---|
| Chemical formula | C11H15N2O8P | Neutral form; often supplied as a salt or hydrate. |
| Molecular weight | 334.22 g/mol | Calculated for C11H15N2O8P. |
| Appearance | White to off-white powder | Color can vary with purity and hydration. |
| Solubility | Soluble in water | Aqueous solutions are acidic and stability depends on pH and temperature. |
| Typical storage | −20 °C or below, desiccated | Protect from light; avoid repeated freeze-thaw cycles. |
Nicotinamide mononucleotide, commonly abbreviated NMN, is a pyridine nucleotide that consists of a nicotinamide ring, a ribose sugar, and a phosphate group. It is an intermediate in the salvage pathway for nicotinamide adenine dinucleotide, or NAD+, synthesis. In mammalian cells, the enzyme nicotinamide phosphoribosyltransferase produces NMN from nicotinamide and phosphoribosyl pyrophosphate. Nicotinamide mononucleotide adenylyltransferases then convert NMN into NAD+. The core structure and enzymatic route are well established in biochemical literature.
The biologically relevant form of NMN is generally the beta anomer, which is recognized by NMN adenylyltransferases. NMN is polar and water soluble, and it does not readily diffuse across lipid membranes without assistance. Whether intact NMN enters cells through a specific transporter remains an open question; some studies propose solute carrier family members, while other work favors extracellular dephosphorylation to nicotinamide riboside followed by uptake. This transport and compartmentalization debate affects how researchers interpret oral administration studies. The distinction between intracellular synthesis and extracellular delivery is central to current discussion.
Inside cells, the enzyme nicotinamide phosphoribosyltransferase, or NAMPT, converts nicotinamide and a ribose-phosphate donor into NMN. A second enzyme, NMN adenylyltransferase, then converts NMN into NAD+. NAD+ participates in redox reactions and serves as a substrate for signaling enzymes such as sirtuins, PARPs, and CD38. Because NAD+ levels tend to decline with age in many organisms, NMN has drawn interest as a possible way to influence that decline. Whether oral NMN reliably raises NAD+ in human tissues, and whether any such change modifies disease risk, remain open research questions.
NMN is present in small amounts in some foods, including certain vegetables, fruits, and animal products, but food content varies widely and is not well standardized. In laboratory research, NMN is used as a tool compound to study NAD+ metabolism, mitochondrial function, and cellular stress responses. Animal studies have reported changes in NAD+ levels and various physiological measures after NMN administration, but species differences and study designs limit direct extrapolation to humans. Human trials have largely focused on safety, tolerability, and pharmacokinetics, with fewer studies examining clinical endpoints.
Work-related roadway crashes are the leading cause of death from traumatic injuries in the U.S. workplace. They accounted for nearly 12,000 deaths between 1992 and 2000. Deaths and injuries from these roadway crashes result in increased costs to employers and lost productivity in addition to their toll in human suffering. Truck drivers tend to endure higher fatality rates than workers in other occupations, but concerns about motor vehicle safety in the workplace are not limited to those surrounding the operation of large trucks. Workers outside the motor carrier industry routinely operate company-owned vehicles for deliveries, sales and repair calls, client visits, etc. In these instances, the employer providing the vehicle generally plays a major role in setting safety, maintenance, and training policy. As in non-occupational driving, young drivers are especially at risk. In the workplace, 45% of all fatal injuries to workers under age 18 between 1992 and 2000 in the United States resulted from transportation incidents.
CUT&RUN sequencing, antibody-targeted controlled cleavage by micrococcal nuclease for transcriptomic profiling. Hydrolysis of nucleic acids in crude cell-free extracts. Sequencing of RNA. Preparation of rabbit reticulocyte lysates. Studies of chromatin structure. Removal of nucleic acids from laboratory protein preparations allowing for protein folding and structure-function studies. Research on the mechanisms of protein folding. Serratia marcescens nuclease http://www.thermoscientificbio.com/dna-and-rna-modifying-enzymes/micrococcal-nuclease/ http://www.worthington-biochem.com/NFCP/default.html http://www.thermoscientificbio.com/uploadedFiles/Resources/en0181-usa-msds.pdf - A material and safety data sheet for the product http://www.thermoscientificbio.com/uploadedFiles/Resources/en018-product-information.pdf - A Product Information sheet Micrococcal+Nuclease at the U.S. National Library of Medicine Medical Subject Headings (MeSH) EC 3.1.31.1
As of 2016, challenges including optimizing sample treatment, optimizing disk surfaces, developing readers that can deploy multiple colors of light delivery and sensing for multiplexing, and for clinical use, obtaining regulatory approvals. The field is similar to lab-on-a-chip platforms. As of 2010 companies including Gyros AB, Tecan, and Burstein Technologies were working on bringing CD/DVD based immunoassays and equipment to market. Bioanalysis Microanalysis Immunoscreening List of chemical analysis methods
Sources: en.wikipedia.org
Years after the conference, people ascribed a large amount of significance to it. According to Paul Berg and Maxine Singer in 1995, the conference marked the beginning of an exceptional era for both science and the public discussion of science policy. The guidelines devised by the conference enabled scientists to conduct experiments with recombinant DNA technology, which by 1995 dominated biological research. This research, in turn, increased knowledge about fundamental life processes, such as the cell cycle. Additionally, the conference, along with public debates on recombinant DNA, increased public interest in biomedical research and molecular genetics. For this reason, by 1995, genetics and its vocabulary had become a part of the daily press and television news. This, in turn, stimulated knowledgeable public discussion about some of the social, political, and environmental issues that emerged from genetic medicine and the use of genetically modified plants in agriculture. Another significant outcome of the conference was the precedent it set about how to respond to changes in scientific knowledge. According to the conference, the proper response to new scientific knowledge was to develop guidelines that governed how to regulate it.
CLE peptides are coded by the CLE genes. These peptides vary in structure, with each peptide structure performing a different job within the plant. The minimal length of functioning CLE peptides has been found to be 12 amino acids with several critical residues. There are two different peptide structures that are found within the plant and they are A-type and B-type. When A-type hormones are secreted the plant slows down the rate of root growth whereas the secretion of B-type peptides effects the vascular growth of the plant. The secretion of A-type peptides speeds up the vascular development of the plant that is mediated by the B-type peptides. This suggests that these two types of peptides work together to regulate the growth of the plant. The specific peptides are: A-type peptides B-type peptides CLE 41/44/TDIF CLE 42 CLE 43 CLE 46
NETA is used as a hormonal contraceptive in combination with estrogen, in the treatment of gynecological disorders such as abnormal uterine bleeding, and as a component of menopausal hormone therapy for the treatment of menopausal symptoms. NETA is available in the form of tablets for use by mouth both alone and in combination with estrogens including estradiol, estradiol valerate, and ethinylestradiol. Transdermal patches providing a combination of 50 μg/day estradiol and 0.14 or 0.25 mg/day NETA are available under the brand names CombiPatch and Estalis. NETA was previously available for use by intramuscular injection in the form of ampoules containing 20 mg NETA, 5 mg estradiol benzoate, 8 mg estradiol valerate, and 180 mg testosterone enanthate in oil solution under the brand name Ablacton to suppress lactation in postpartum women. Side effects of NETA include menstrual irregularities, headaches, nausea, breast tenderness, mood changes, acne, increased hair growth, and others.
Sources: en.wikipedia.org
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Chemical antagonism occurs when a chemical antagonist combines with a ligand to form an inactive product compound, inhibiting the response. In chemical antagonism, the receptors are not involved in the process, and the antagonist directly binds with or removes the ligand. It prevents the ligand from binding to the receptor. As the ligand cannot stimulate the receptor, no physiological effect is generated by the receptors and thus provides an inhibitory effect. The common types of chemical antagonism include chelating agents, neutralising antibodies and salt aggregation.
Immobilized metal ion affinity chromatography (IMAC) is based on the specific coordinate covalent bond of amino acids, particularly histidine, to metals. This technique works by allowing proteins with an affinity for metal ions to be retained in a column containing immobilized metal ions, such as cobalt, nickel, or copper for the purification of histidine-containing proteins or peptides, iron, zinc or gallium for the purification of phosphorylated proteins or peptides. Many naturally occurring proteins do not have an affinity for metal ions, therefore recombinant DNA technology can be used to introduce such a protein tag into the relevant gene. Methods used to elute the protein of interest include changing the pH, or adding a competitive molecule, such as imidazole.
GLP-1 is effective at reducing blood glucose levels. GLP-1 analogs have a significant therapeutic effect and high efficacy on diabetes treatments and hypoglycemia prevention. Proliferation effect and trophic effect on the small intestine, GLP-2 is used as a therapy to support patients with short-bowel syndrome and other underlying intestinal conditions. Proglucagon Overview at colostate.edu Nosek, Thomas M. "Section 6/6ch2/s6ch2_27". Essentials of Human Physiology. Archived from the original on 2016-03-24. Enteroglucagon at the U.S. National Library of Medicine Medical Subject Headings (MeSH)
Sources: en.wikipedia.org
NMN is nicotinamide mononucleotide, a nucleotide intermediate in NAD+ biosynthesis. It consists of nicotinamide, ribose, and phosphate groups.
No. NMN is a precursor, while NAD+ is the dinucleotide product formed after an adenylate group is added. They are distinct molecules with different cellular roles.
Small amounts of NMN have been reported in several foods, including some vegetables and meats. The concentrations are variable and usually much lower than those used in laboratory research.
NMN stands for nicotinamide mononucleotide. It is a nucleotide composed of nicotinamide, ribose, and phosphate. In cells, it is an intermediate in NAD+ biosynthesis.