A practical reference on quality control: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2026-04-10 and is reviewed periodically as new material appears.
Quantifying glutathione requires distinguishing GSH from GSSG and preventing oxidation during sample preparation. Common approaches include the enzymatic recycling assay, often called the Tietze method, which measures total glutathione after converting GSSG to GSH. HPLC with ultraviolet or fluorescence detection and LC-MS/MS can separate and quantify both forms, sometimes after derivatization of the thiol group. Blood, plasma, and tissue samples differ in matrix and baseline concentrations, so method validation must account for recovery, linearity, and interference. No single assay is universally standard.
Glutathione is most stable as a dry powder stored cool and dry, but its thiol group is readily oxidized in solution. Aqueous preparations at neutral or alkaline pH lose GSH faster because the thiolate form reacts with dissolved oxygen and metal ions. Acidic conditions, chelating agents, and oxygen exclusion can slow oxidation, while repeated freeze-thaw cycles promote degradation. Light exposure and trace metals also contribute to loss. Laboratories typically validate stability for their own matrices because degradation rates depend on pH, temperature, concentration, and container materials.
Biosynthesis occurs in two ATP-dependent steps. The enzyme glutamate-cysteine ligase joins glutamate and cysteine, forming gamma-glutamylcysteine; glutathione synthetase then adds glycine to produce the complete tripeptide. Because the peptide bond from glutamate uses the gamma-carboxyl group, glutathione resists digestion by many ordinary peptidases. Tissues vary in synthesis capacity, and the liver generally contains high concentrations relative to many other organs. This uneven distribution contributes to organ-specific differences in redox buffering and affects how experimental results are interpreted across tissue types.
Glutathione participates in detoxification reactions, amino acid transport, and the maintenance of protein thiols. It serves as a cofactor for several enzymes, including glutathione peroxidases and glutathione S-transferases. In research literature, altered glutathione status appears in studies of aging, infection, metabolic stress, and environmental exposure. Whether low glutathione is a cause, consequence, or marker of such conditions often remains unresolved. Direct measurement in blood or tissue provides a snapshot, but results depend on sample handling, timing, and the method used.
| Property | Value | Notes |
|---|---|---|
| Typical assay | Enzymatic recycling assay (Tietze) | Measures total glutathione after reduction of GSSG. |
| Separation method | HPLC or LC-MS/MS | Can quantify GSH and GSSG separately with appropriate standards. |
| Solid storage | -20 °C, desiccated, protect from light | Dry powder is more stable than aqueous solutions. |
| Solution storage | Acidic pH, -80 °C, aliquot | Reduce oxygen exposure and freeze-thaw cycling. |
| Oxidation product | Glutathione disulfide (GSSG) | Formed by thiol oxidation; often measured as a stress marker. |
Quantification of glutathione in biological or food samples commonly uses liquid chromatography coupled to ultraviolet, fluorescence, electrochemical, or mass spectrometric detection. Because the thiol group oxidizes readily, samples are often acidified or derivatized immediately after collection to stabilize reduced glutathione. Enzymatic recycling assays and colorimetric kits offer higher throughput but generally lower specificity than chromatographic methods. Mass spectrometry can distinguish glutathione from related thiols and allow simultaneous measurement of oxidized forms. Reported concentrations depend strongly on sample type, extraction procedure, and analytical platform.
Glutathione reference materials are sensitive to oxygen, light, and elevated temperature. Solid material is typically stored desiccated at -20 °C or below, while solutions require tighter control because thiol oxidation proceeds faster in liquid form. Aqueous solutions are often prepared fresh, kept cold, and protected from air; some protocols add acid or chelating agents to slow metal-catalyzed oxidation. Repeated freeze-thaw cycles can accelerate degradation and should be avoided. Stability data vary by matrix, so laboratories usually verify performance with their own storage conditions.
Quality control for glutathione measurements includes calibration with authenticated standards, internal standards where available, blank correction, and spike recovery checks. Because glutathione can form during sample processing or degrade before analysis, pre-analytical handling is a major source of variability. Interlaboratory comparisons often show differences in reported values due to method-specific calibration and detection principles. Interpretive thresholds are context-dependent, and no single reference range applies across all tissues or matrices. Researchers generally report both reduced and oxidized forms, along with the method and sample handling details.
Glutathione is a small tripeptide composed of glutamate, cysteine, and glycine, with the unusual gamma-glutamyl linkage between glutamate and cysteine. Its cysteine thiol group makes it a major non-enzymatic antioxidant in cells. The reduced form, GSH, predominates in most intracellular compartments, while the oxidized disulfide form, GSSG, is produced when GSH reduces reactive oxygen species. Intracellular concentrations often reach millimolar levels, whereas plasma concentrations are much lower, typically in the low micromolar range. This gradient reflects active synthesis, transport, and consumption rather than passive distribution.
Synthesis occurs in two ATP-dependent steps: glutamate-cysteine ligase joins glutamate and cysteine to form gamma-glutamylcysteine, and glutathione synthetase adds glycine to complete the tripeptide. The pathway is feedback-inhibited by GSH and limited by cysteine availability, so cysteine supply often constrains production. Once formed, GSH participates in redox buffering, xenobiotic conjugation, and protein glutathionylation. Glutathione peroxidase uses GSH to reduce hydrogen peroxide and lipid peroxides, yielding GSSG, while glutathione reductase regenerates GSH using NADPH. Glutathione S-transferases conjugate electrophiles to GSH, supporting detoxification and excretion.
Because GSH is central to redox balance, its status is studied in aging, liver disease, neurodegenerative conditions, and metabolic disorders. Observational studies often report lower GSH or higher GSSG in affected tissues, but such associations do not establish that raising glutathione changes disease outcomes. Oral glutathione is digested into amino acids, and whether intact absorption occurs remains debated; precursors such as N-acetylcysteine and cysteine donors are also investigated. Regulatory agencies generally treat glutathione as a dietary supplement, not an approved drug, and clinical claims require evidence from controlled trials.
==== Approved topical medicine ==== In the European Union, a prescription gel containing birch bark extract (commercial name Episalvan, betulae cortex dry extract (5–10 : 1); extraction solvent: n-heptane 95% (w/w)) was approved in 2016 for the topical treatment of minor skin wounds in adults. Although its mechanism of action in helping to heal injured skin is not fully understood, birch bark extract appears to stimulate the growth of keratinocytes which then fill the wound.
== Structure == Optimer ligands are composed of single-stranded DNA or RNA polymers. These nucleic acid molecules can exhibit cognate base-pairing to produce sections of double-stranded DNA or RNA within the Optimer molecules. Optimer ligands form secondary and tertiary structures with compatible internal base-pairing at specific portions of the ligand where possible according to the specific sequence. As not all of the bases in the Optimer sequence will be compatible for internal double-stranded pairing, single-stranded loop and bulge regions will remain in the secondary and tertiary structures, where hydrogen bond acceptor and donor groups are exposed and available to interact with the selected target for target engagement and target binding. The Optimer library that is screened for specific binders consists of 1014 sequences that will form different variable sequence-dependent structures. The wide diversity in this library enables target binding to a range of different molecules. Optimer molecules can bind crevices and exposed epitopes on protein and cellular targets and can wrap around small molecule targets. This enables an increased target range compared to traditional antibody technology that has limitations in accurately binding small molecule targets. As Optimer technology stems from aptamers, Optimer ligands have the ability to operate as reversible structural switches, changing their structure when binding their target molecule.
In its 2018 Gen Z Music Consumption & Spending Report, digital media company Sweety High found that Generation Z was listening to more diverse music genres than generations past, whose music preferences solidified by early adolescence. Spotify was the most popular source of music for Generation Z (61%), followed by terrestrial radio ranked second (55%), while YouTube was the preferred platform for music discovery (75%). TikTok is another major platform for music discovery and for Generation Z to connect with their favorite musicians. Research on popular music from the 1950s to the 2010s has shown that this genre has become louder, while the chords, melodies, and types of sounds used have becoming increasingly homogenized. At the same time, lyrics of the most popular songs have becoming less joyful, sadder, and angrier. Such shifts have occurred due to changing consumer tastes. In particular, the melancholic lyrics of Billie Eilish and Olivia Rodrigo resonate with their generation. A 2019 poll by Ypulse found that for teenagers (13 to 18), the top musicians were Billie Eilish and Ariana Grande whereas among young adults (19 to 26), the most liked were Taylor Swift and Ariana Grande. Chinese music video app Musical.ly was highly popular among American teens. In 2018, Musical.ly was shut down and its users were transferred to TikTok. By the early 2020s, TikTok has become one of the most popular social networks among teenagers and young adults in the United States.
=== Schizophrenia === Both liquid chromatography and liquid chromatography/mass spectrometric assays have found that brain tissue of deceased people with schizophrenia shows altered arginine metabolism. Assays also confirmed significantly reduced levels of γ-aminobutyric acid (GABA), but increased agmatine concentration and glutamate/GABA ratio in the schizophrenia cases. Regression analysis indicated positive correlations between arginase activity and the age of disease onset and between L-ornithine level and the duration of illness. Moreover, cluster analyses revealed that L-arginine and its main metabolites L-citrulline, L-ornithine and agmatine formed distinct groups, which were altered in the schizophrenia group. Despite this, the biological basis of schizophrenia is still poorly understood, a number of factors, such as dopamine hyperfunction, glutamatergic hypofunction, GABAergic deficits, cholinergic system dysfunction, stress vulnerability and neurodevelopmental disruption, have been linked to the aetiology and/or pathophysiology of the disease.
Sources: en.wikipedia.org
The Inca roads were used to transport food, goods, people, and armies, while Inca officials frequently relayed messages using the roads across the vast stretches of the Inca Empire. In areas, where rivers blocked the directions of the roads, the Inca constructed elaborate and complex rope bridges.
Choh Hao Li (sometimes Cho Hao Li) (Chinese: 李卓皓; pinyin: Lǐ Zhuōhào; April 21, 1913 – November 28, 1987) was a Chinese-born American biochemist who discovered in 1966 that human pituitary growth hormone (somatotropin) consists of a chain of 256 amino acids. In 1970, he succeeded in synthesizing this hormone, the largest protein molecule synthesized up to that time.
Opioid receptors are a group of inhibitory G protein-coupled receptors with opioids as ligands. The endogenous opioids are dynorphins, enkephalins, endorphins, endomorphins and nociceptin. Even though at the cellular level they are inhibitory, their activation is not always inhibitory: for example, activation of mu-opioid receptors activates (not inhibits) dopamine release, and activation of kappa-opioid receptors can lead to noradrenaline release, due to the location of these receptors on suppressor-cells releasing these neurotransmitters . The opioid receptors are ~40% identical to somatostatin receptors (SSTRs). Opioid receptors are distributed widely in the brain, in the spinal cord, on peripheral neurons, and digestive tract.
Sources: en.wikipedia.org
=== United States === As of July 2012, only six states lack legislation to regulate the professional practice of TCM: Alabama, Kansas, North Dakota, South Dakota, Oklahoma, and Wyoming. In 1976, California established an Acupuncture Board and became the first state licensing professional acupuncturists.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
== See also == Category:Cutaneous conditions Dermatology List of conditions associated with café au lait macules List of contact allergens List of cutaneous conditions associated with increased risk of nonmelanoma skin cancer List of cutaneous conditions associated with internal malignancy List of cutaneous conditions caused by mutations in keratins List of cutaneous neoplasms associated with systemic syndromes List of cutaneous conditions caused by problems with junctional proteins List of dental abnormalities associated with cutaneous conditions List of genes mutated in cutaneous conditions List of genes mutated in pigmented cutaneous lesions List of histologic stains that aid in diagnosis of cutaneous conditions List of human leukocyte antigen alleles associated with cutaneous conditions List of immunofluorescence findings for autoimmune bullous conditions List of inclusion bodies that aid in diagnosis of cutaneous conditions List of keratins expressed in the human integumentary system List of migrating cutaneous conditions List of mites associated with cutaneous reactions List of radiographic findings associated with cutaneous conditions List of specialized glands within the human integumentary system List of spiders associated with cutaneous reactions List of target antigens in pemphigoid List of target antigens in pemphigus List of verrucous carcinoma subtypes List of xanthoma variants associated with hyperlipoproteinemia subtypes
Sources: en.wikipedia.org
The ratio depends on rapid separation or blocking of GSH before oxidation occurs. GSSG can be formed ex vivo if samples are not processed quickly in cold, acidic conditions. Even small delays can shift the apparent ratio, making standardized protocols essential.
Enzymatic recycling assays measure total glutathione, while HPLC and LC-MS/MS can resolve GSH and GSSG separately. Derivatization or thiol-blocking reagents are sometimes used to stabilize and detect the compounds. Method choice depends on the sample type and required specificity.
Dry glutathione powder is typically stored at -20 °C in a desiccated container protected from light. Solutions should be prepared fresh, kept acidic or frozen, and avoid repeated freeze-thaw cycles. Stability should be confirmed for each specific laboratory condition.
GSH is the reduced form of glutathione, with a free thiol group on cysteine. GSSG is the oxidized disulfide form, created when two GSH molecules become linked. The two forms exist together, and their balance is often reported as the GSH/GSSG ratio in laboratory studies.